Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human DPEP2 neighbor protein (DP2NB)

This Recombinant Human DPEP2 neighbor protein (DP2NB) spans the amino acid sequence from region 1-123. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DPEP2 neighbor protein DPEP2NB

UniProt

A0A0U1RQF7

Expression Region

1-123

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MTDRILYIVSNMSSVPWEGSAAAAVPATSPPTPGHYHVLYRGCGETQVGWHGETYCLVGGYRVHGDAPLATPTKAEAEKPAPRRAPKRRQATIESDKDLGCSSPKIRRLEHRGRRLTPQKLAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Goat IgG,
AAF-013-1 1 mL

Alkaline Phosphatase Conjugated Rabbit Affinity Purified Antibody to Goat IgG,

Sign In for Pricing
View Details
PRAS40 (AKT1S1) (NM_001098632) Human Over-expression Lysate
LC420655 20 µg

PRAS40 (AKT1S1) (NM_001098632) Human Over-expression Lysate

Sign In for Pricing
View Details
MIR3126 Human qPCR Primer Pair (MI0014143)
HP300734 200 Reactions

MIR3126 Human qPCR Primer Pair (MI0014143)

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 RJ4,  30nm
GM-207-30 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG4 RJ4, 30nm

Sign In for Pricing
View Details
Calcitonin (CALCA) Rabbit Polyclonal Antibody
TA364040 50 µL

Calcitonin (CALCA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Artery: peripheral
CS624428 5x 5 µm

Frozen Tissue Sections, Artery: peripheral

Sign In for Pricing
View Details