Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial

This Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial spans the amino acid sequence from region 24-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial sheath formation-associated protein; Putative transmembrane protein SPTY2D1OS; SPTY2D1 antisense RNA 1; SPTY2D1 opposite strand; MISFA SPTY2D1-AS1 SPTY2D1OS

UniProt

A0A0U1RRN3

Expression Region

24-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057757-01 0.1 mL

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057757-02 0.2 mL

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057757-03 0.5 mL

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057757-04 1 mL

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057757-05 5 mL

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)
MBS2057757-06 5x 5 mL

FITC-Linked Polyclonal Antibody to Melanoma Cell Adhesion Molecule (MCAM)

Sign In for Pricing
View Details