Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial

This Recombinant Human Mitochondrial sheath formation-associated protein (MISFA), partial spans the amino acid sequence from region 24-59. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial sheath formation-associated protein; Putative transmembrane protein SPTY2D1OS; SPTY2D1 antisense RNA 1; SPTY2D1 opposite strand; MISFA SPTY2D1-AS1 SPTY2D1OS

UniProt

A0A0U1RRN3

Expression Region

24-59

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

PPTLKWQERWPVQESKTQLRRRALGEDLLQNHVEGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Phospho 5TAT3 (5727) Recombinant Monoclonal Antibody [BLR160J]
A700-160-T 20 µL (2 Blots)

Rabbit anti-Phospho 5TAT3 (5727) Recombinant Monoclonal Antibody [BLR160J]

Sign In for Pricing
View Details
GCSF Receptor/CSF3R Rabbit Polyclonal Antibody (APC)
orb2576414 100 µg

GCSF Receptor/CSF3R Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Mouse Caspase 14 (CASP14) ELISA Kit
EKU10085 96 Tests

Mouse Caspase 14 (CASP14) ELISA Kit

Sign In for Pricing
View Details
Rabbit Polyclonal CLCN2 Antibody
NBP1-85585-25ul 25 µL

Rabbit Polyclonal CLCN2 Antibody

Sign In for Pricing
View Details
MAD4 (MXD4) (NM_006454) Human Tagged ORF Clone Lentiviral Particle
RC209651L3V 200 µL

MAD4 (MXD4) (NM_006454) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CPOX
enz-701 5µg

CPOX

Sign In for Pricing
View Details