Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 6-4 (TVB64)

This Recombinant Human T cell receptor beta variable 6-4 (TVB64) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 6-4 TRBV6-4

UniProt

A0A1B0GX49

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GITQAPTSQILAAGRSMTLRCTQDMRHNAMYWYRQDLGLGLRLIHYSNTAGTTGKGEVPDGYSVSRANTDDFPLTLASAVPSQTSVYFCASSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cystatin A Rabbit Polyclonal Antibody (BF350)
orb2413484 100 µL

Cystatin A Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
SATB1 Peptide
4631P 0.05 mg

SATB1 Peptide

Sign In for Pricing
View Details
USP2, CT (L523) (Ubiquitin Carboxyl-terminal Hydrolase 2, Ubiquitin Thiolesterase 2, Ubiquitin-specific Processing Protease 2, Deubiquitinating Enzyme 2, 41kD Ubiquitin-specific Protease, UBP41) (AP) discontinued
U4099-60D-AP 200 µL

USP2, CT (L523) (Ubiquitin Carboxyl-terminal Hydrolase 2, Ubiquitin Thiolesterase 2, Ubiquitin-specific Processing Protease 2, Deubiquitinating Enzyme 2, 41kD Ubiquitin-specific Protease, UBP41) (AP) discontinued

Sign In for Pricing
View Details
ALG3 Knockout HEK293T Polyclonal Cells
ARG25661 1 Million

ALG3 Knockout HEK293T Polyclonal Cells

Sign In for Pricing
View Details
Srms (Tyrosine-Protein Kinase Srms, PTK70, Srms, Srm) (MaxLight 750) discontinued
302775-ML750 100 µL

Srms (Tyrosine-Protein Kinase Srms, PTK70, Srms, Srm) (MaxLight 750) discontinued

Sign In for Pricing
View Details
Rabbit Monoclonal BCMA/TNFRSF17 Antibody (CD269/8125R) [PerCP]
NBP3-20823PCP 0.1 mL

Rabbit Monoclonal BCMA/TNFRSF17 Antibody (CD269/8125R) [PerCP]

Sign In for Pricing
View Details