Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NANOG for Basic Luciferase Vectors (LR-2XXX)
LR-2050 1 Each

NANOG for Basic Luciferase Vectors (LR-2XXX)

Sign In for Pricing
View Details
NDUFB9 Recombinant Antibody, PE-Cy5.5 Conjugated
bsm-62588R-PE-Cy5.5 100 µL

NDUFB9 Recombinant Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Recombinant DEAD Box Polypeptide 5 (DDX5)
RPU59415-01 50 µg

Recombinant DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details
Recombinant DEAD Box Polypeptide 5 (DDX5)
RPU59415-02 100 µg

Recombinant DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details
Recombinant DEAD Box Polypeptide 5 (DDX5)
RPU59415-03 1 mg

Recombinant DEAD Box Polypeptide 5 (DDX5)

Sign In for Pricing
View Details
DDRGK1 Rabbit Polyclonal Antibody (BF555)
orb2385490 100 µL

DDRGK1 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details