Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eif1a Mouse qPCR Primer Pair (NM_010120)
MP204377 200 Reactions

Eif1a Mouse qPCR Primer Pair (NM_010120)

Sign In for Pricing
View Details
Rabbit Monoclonal PABPN1 Antibody (7V4X8)
NBP3-15539-20ul 20 µL

Rabbit Monoclonal PABPN1 Antibody (7V4X8)

Sign In for Pricing
View Details
TRNAV1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K2528107 1.0 µg DNA

TRNAV1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
FBXL2 Human Over-expression Lysate
orb1339325 100 µg

FBXL2 Human Over-expression Lysate

Sign In for Pricing
View Details
PIGP Recombinant Protein Antigen
NBP1-84294PEP 0.1 mL

PIGP Recombinant Protein Antigen

Sign In for Pricing
View Details
CD59 glycoprotein CD59 Rabbit Polyclonal Antibody (Fluoro594)
orb3074397 100 µg

CD59 glycoprotein CD59 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details