Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CUZD1 (E-10) : m-IgGκ BP-HRP Bundle
sc-524778 1 Kit

CUZD1 (E-10) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details
Recombinant Mycobacterium Avium rplU Protein(aa 1-103)
VAng-Yyj1432-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Avium rplU Protein(aa 1-103)

Sign In for Pricing
View Details
Recombinant human Cystatin C protein
ATGP2040-050 50 µg

Recombinant human Cystatin C protein

Sign In for Pricing
View Details
ERI1 (9L11) Mouse Monoclonal antibody
E28PE5356 100 µL

ERI1 (9L11) Mouse Monoclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Map7d3 shRNA (UAS) - Lentiviral mouseMap7d3 shRNA (UAS, GFP) (25)
GTR15274136 1 Vial

Lentiviral mouse Map7d3 shRNA (UAS) - Lentiviral mouseMap7d3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Sh3gl1 ORF Vector (Rat) (pORF)
ORF076188 1.0 µg DNA

Sh3gl1 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details