Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 1 (TRDV1)

This Recombinant Human T cell receptor delta variable 1 (TRDV1) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 1 TRDV1

UniProt

A0A1B0GX56

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QKVTQAQSSVSMPVRKAVTLNCLYETSWWSYYIFWYKQLPSKEMIFLIRQGSDEQNAKSGRYSVNFKKAAKSVALTISALQLEDSAKYFCALGE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human PIGZ shRNA (UAS) - Lentiviral human PIGZ shRNA (UAS, GFP) plasmid
GTR15324361 1 Vial

Lentiviral human PIGZ shRNA (UAS) - Lentiviral human PIGZ shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
Lentiviral human TDRKH shRNA (UAS) - Lentiviral human TDRKH shRNA (UAS, iRFP) (25)
GTR15335009 1 Vial

Lentiviral human TDRKH shRNA (UAS) - Lentiviral human TDRKH shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
EXOSC9 siRNA (m)
sc-144981 10 µM

EXOSC9 siRNA (m)

Sign In for Pricing
View Details
ABLIM1 Antibody, Biotin conjugated
A11625-100UG 100 µg

ABLIM1 Antibody, Biotin conjugated

Sign In for Pricing
View Details
APAF1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated
bsm-61152R-BF594-TR 20 µL

APAF1 Recombinant Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
FITC-Linked Polyclonal Antibody to Mucosae Associated Epithelia Chemokine (MEC)
MBS2056708-01 0.1 mL

FITC-Linked Polyclonal Antibody to Mucosae Associated Epithelia Chemokine (MEC)

Sign In for Pricing
View Details