Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

N-Fmoc- (2R,3R) -3-Amino-3- (2-fluoro-phenyl) -2- hydroxy-propionic acid
CSB-DT4324 0.1 g

N-Fmoc- (2R,3R) -3-Amino-3- (2-fluoro-phenyl) -2- hydroxy-propionic acid

Sign In for Pricing
View Details
1.0 M Magnesium Chloride DEPC TREATED
OORA00232-100ML 100 mL

1.0 M Magnesium Chloride DEPC TREATED

Sign In for Pricing
View Details
CaMKIδ CRISPR Activation Plasmid (h)
sc-403073-ACT 20 µg

CaMKIδ CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
Ub (Acetyl Lys29) Polyclonal Antibody
E20-40054 100 µg

Ub (Acetyl Lys29) Polyclonal Antibody

Sign In for Pricing
View Details
C9orf152 Protein Vector (Human) (pPB-C-His)
PV066985 500 ng

C9orf152 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Gsg1l (NM_001101488) Mouse Recombinant Protein
PM44515M5 20 µg

Gsg1l (NM_001101488) Mouse Recombinant Protein

Sign In for Pricing
View Details