Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNX26 (ARHGAP33) Human shRNA Plasmid Kit (Locus ID 115703)
TR301469 1 Kit

SNX26 (ARHGAP33) Human shRNA Plasmid Kit (Locus ID 115703)

Sign In for Pricing
View Details
DICER1 antibody
70R-16836 50 ul

DICER1 antibody

Sign In for Pricing
View Details
C6ORF47-AS1 AAV Vector (Human) (CMV)
14650101 1 µg

C6ORF47-AS1 AAV Vector (Human) (CMV)

Sign In for Pricing
View Details
Human DAP knockout cell line
ABC-KH3929 1 Vial

Human DAP knockout cell line

Sign In for Pricing
View Details
PXR (NR1I2) Human siRNA Oligo Duplex (Locus ID 8856)
SR305848 1 Kit

PXR (NR1I2) Human siRNA Oligo Duplex (Locus ID 8856)

Sign In for Pricing
View Details
Rabbit Anti Human ATXN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence)
IRBAMLATXN1AP80120UL 1 Each

Rabbit Anti Human ATXN1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence)

Sign In for Pricing
View Details