Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 2 (TVB2)

This Recombinant Human T cell receptor beta variable 2 (TVB2) spans the amino acid sequence from region 20-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 2 TRBV2

UniProt

A0A1B0GX68

Expression Region

20-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EPEVTQTPSHQVTQMGQEVILRCVPISNHLYFYWYRQILGQKVEFLVSFYNNEISEKSEIFDDQFSVERPDGSNFTLKIRSTKLEDSAMYFCASSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)
MBS6287364-01 0.2 mL

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)

Sign In for Pricing
View Details
CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)
MBS6287364-02 5x 0.2 mL

CNTN1, ID (CNTN1, Contactin-1, Glycoprotein gp135, Neural cell surface protein F3) (FITC)

Sign In for Pricing
View Details
CCRK (Cell Cycle Related Kinase, CDCH, p42) (MaxLight 550)
244336-ML550 100 µL

CCRK (Cell Cycle Related Kinase, CDCH, p42) (MaxLight 550)

Sign In for Pricing
View Details
Aricine
orb1683134 5 mg

Aricine

Sign In for Pricing
View Details
HBV HBeAg Matched Antibody Pair Set [ABP-S-052732]
ABP-S-052732 5 Plates

HBV HBeAg Matched Antibody Pair Set [ABP-S-052732]

Sign In for Pricing
View Details
MPPE1, CT (MPPE1, PGAP5, Metallophosphoesterase 1, Post-GPI attachment to proteins factor 5) (APC)
MBS6321956-01 0.2 mL

MPPE1, CT (MPPE1, PGAP5, Metallophosphoesterase 1, Post-GPI attachment to proteins factor 5) (APC)

Sign In for Pricing
View Details