Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECHDC1 (C-term) Rabbit Polyclonal Antibody
AP51357PU-N 400 µL

ECHDC1 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
IFluor® 647-Wheat Germ Agglutinin (WGA) Conjugate
25559-AAT 1 mg

IFluor® 647-Wheat Germ Agglutinin (WGA) Conjugate

Sign In for Pricing
View Details
GPR22 Rabbit Polyclonal Antibody
TA376735 100 µL

GPR22 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
RNASEH1P1 Human qPCR Primer Pair (XM_208175)
HP221256 200 Reactions

RNASEH1P1 Human qPCR Primer Pair (XM_208175)

Sign In for Pricing
View Details
Mosmo Mouse Gene Knockout Kit (CRISPR)
KN502033 1 Kit

Mosmo Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Slc2a3 Mouse Gene Knockout Kit (CRISPR)
KN516030 1 Kit

Slc2a3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details