Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 12-5 (TVBL5)

This Recombinant Human T cell receptor beta variable 12-5 (TVBL5) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 12-5 TRBV12-5

UniProt

A0A1B0GX78

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RVTQTPRHKVTEMGQEVTMRCQPILGHNTVFWYRQTMMQGLELLAYFRNRAPLDDSGMPKDRFSAEMPDATLATLKIQPSEPRDSAVYFCASGL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I,  15nm
GM-15-15 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I, 15nm

Sign In for Pricing
View Details
Calnexin (CANX) Rabbit Monoclonal Antibody [Clone ID: R07-2B1]
TA383866 100 µL

Calnexin (CANX) Rabbit Monoclonal Antibody [Clone ID: R07-2B1]

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (C3e/3171R), CF640R conjugate, 0.1mg/mL
BNC403171-500 1x 500 µL

CD3e (T-Cell Marker) (C3e/3171R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cortactin Rabbit Polyclonal Antibody
AP02765PU-N 100 µL

Cortactin Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Octahydroindoline-2-carboxylic Acid Benzyl Ester (-)-Dibenzoyl-L-tartaric Acid
TRC-O236505-50MG 50 mg

Octahydroindoline-2-carboxylic Acid Benzyl Ester (-)-Dibenzoyl-L-tartaric Acid

Sign In for Pricing
View Details
Cytokeratin 14 (KRT14/532), CF740 conjugate, 0.1mg/mL
BNC740532-100 1x 100 µL

Cytokeratin 14 (KRT14/532), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details