Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72)

This Recombinant Human T cell receptor beta variable 7-2 (TVB72) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Cyclin I2 (CCNI2) ELISA Kit
GTR10339015 96 Well

Mouse Cyclin I2 (CCNI2) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human KCNJ15 Protein - (Dry Ice)
H00003772-P01-2ug 2 µg

Recombinant Human KCNJ15 Protein - (Dry Ice)

Sign In for Pricing
View Details
CHL1 Protein (N-His, Human)
P502538 100 µg

CHL1 Protein (N-His, Human)

Sign In for Pricing
View Details
Human IL-22BP Alexa Fluor 594 Antibody (Clone 875504)
FAB10871T-100UG 100 µg

Human IL-22BP Alexa Fluor 594 Antibody (Clone 875504)

Sign In for Pricing
View Details
Samd1 (NM_001081415) Mouse Tagged ORF Clone
MG221267 10 µg

Samd1 (NM_001081415) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Ube2n (NM_053928) Rat Tagged Lenti ORF Clone
RR205809L4 10 µg

Ube2n (NM_053928) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details