Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 7-2 (TVB72)

This Recombinant Human T cell receptor beta variable 7-2 (TVB72) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 7-2 TRBV7-2

UniProt

A0A1B0GXF2

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVSQSPSNKVTEKGKDVELRCDPISGHTALYWYRQSLGQGLEFLIYFQGNSAPDKSGLPSDRFSAERTGGSVSTLTIQRTQQEDSAVYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PMP22 (NM_000304) Human Over-expression Lysate
LY424810 100 µg

PMP22 (NM_000304) Human Over-expression Lysate

Sign In for Pricing
View Details
TGFB1, NT (TGFB1, TGFB, Transforming growth factor beta-1, Latency-associated peptide) (Biotin)
MBS6355164-01 0.2 mL

TGFB1, NT (TGFB1, TGFB, Transforming growth factor beta-1, Latency-associated peptide) (Biotin)

Sign In for Pricing
View Details
TGFB1, NT (TGFB1, TGFB, Transforming growth factor beta-1, Latency-associated peptide) (Biotin)
MBS6355164-02 5x 0.2 mL

TGFB1, NT (TGFB1, TGFB, Transforming growth factor beta-1, Latency-associated peptide) (Biotin)

Sign In for Pricing
View Details
PDE3A (cGMP-inhibited 3',5'-cyclic Phosphodiesterase A, Cyclic GMP-inhibited Phosphodiesterase A, CGI-PDE A) (FITC)
131047-FITC 100 µL

PDE3A (cGMP-inhibited 3',5'-cyclic Phosphodiesterase A, Cyclic GMP-inhibited Phosphodiesterase A, CGI-PDE A) (FITC)

Sign In for Pricing
View Details
CD11c Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61135R-BF350-01 20 µL

CD11c Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details
CD11c Recombinant Antibody, AbBy Fluor™ 350 Conjugated
bsm-61135R-BF350-02 100 µL

CD11c Recombinant Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details