Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A-like 3 (H2AL3)

This Recombinant Human Histone H2A-like 3 (H2AL3) spans the amino acid sequence from region 1-148. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A-like 3; H2A.L.3; H2AL3 H2AL1RP

UniProt

A0A3B3IU63

Expression Region

1-148

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEEEEKEEEMVVLVVMGGRRRRRRRRRRKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mandipropamid
TRC-M163000-10MG 10 mg

Mandipropamid

Sign In for Pricing
View Details
ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF647 conjugate, 0.1mg/mL
BNC472035-100 1x 100 µL

ZAP70 (Chronic Lymphocytic Leukemia Marker) (ZAP70/2035), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-(2,2,2-Trifluoroethoxy)phenol
TRC-T790190-2.5G 2.5 g

2-(2,2,2-Trifluoroethoxy)phenol

Sign In for Pricing
View Details
CD11a (Cris-3), CF568 conjugate, 0.1mg/mL
BNC680151-500 1x 500 µL

CD11a (Cris-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
2-Chlorophenyl Cyclopentyl Ketone
TRC-C377820-2.5G 2.5 g

2-Chlorophenyl Cyclopentyl Ketone

Sign In for Pricing
View Details
LPGAT1 (NM_014873) Human Over-expression Lysate
LY402383 100 µg

LPGAT1 (NM_014873) Human Over-expression Lysate

Sign In for Pricing
View Details