Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Histone H2A-like 3 (H2AL3)

This Recombinant Human Histone H2A-like 3 (H2AL3) spans the amino acid sequence from region 1-148. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H2A-like 3; H2A.L.3; H2AL3 H2AL1RP

UniProt

A0A3B3IU63

Expression Region

1-148

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MAGNKMFCRPRRQRLSHSRRAELQFPVSHLERCLRESQHARHLSSTTPVFLAGVLEYLTANILEKVGKEVKNSCRLCITPEHVKRALQKDEQLRWILELEDDTHSQVEEMPQSEEEEEEEEEKEEEMVVLVVMGGRRRRRRRRRRKDS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC153 Human Gene Knockout Kit (CRISPR)
KN417435 1 Kit

CCDC153 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Zinc Glycinate
TRC-Z439670-1G 1 g

Zinc Glycinate

Sign In for Pricing
View Details
1,1,1,2,2-Pentafluoro-4-iodobutane
TRC-P270310-5G 5 g

1,1,1,2,2-Pentafluoro-4-iodobutane

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381J-01 20 Tests

PerCP/Cyanine5.5 Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381J-02 100 Tests

PerCP/Cyanine5.5 Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details
PerCP/Cyanine5.5 Anti-Human CD158b/j Antibody[DX27]
E-AB-F1381J-03 2x 100 Tests

PerCP/Cyanine5.5 Anti-Human CD158b/j Antibody[DX27]

Sign In for Pricing
View Details