Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9)

This Recombinant Human Testis-specific Y-encoded protein 9 (TSPY9) spans the amino acid sequence from region 1-314. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Testis-specific Y-encoded protein 9 TSPY9 TSPY9P

UniProt

A0A494C1R9

Expression Region

1-314

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MRPEGSLTYRVPERLRQGFCGVGRAAQALVCASAKEGTAFRMEAVQEGAAGVESEQAALGEEAVLLLDDIMAEVEVVAEVEVVAEEEGLVERREEAQRAQQAVPGPGPMTPESALEELLAVQVELEPVNAQARKAFSRQREKMERRRKPQLDRRGAVIQSVPGFWANVIANHPQMSALITDEDEDMLSYMVSLEVEEEKHPVHLCKIMLFFRSNPYFQNKVITKEYLVNITEYRASHSTPIEWYPDYEVEAYRRRHHNSSLNFFNWFSDHNFAGSNKIAEILCKDLWRNPLQYYKRMKPPEEGTETSGDSQLLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

APOL6 Rabbit Polyclonal Antibody
TA361647 100 µL

APOL6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
AATOM™ 565 Acid, 5-Isomer
2826-AAT 25 mg

AATOM™ 565 Acid, 5-Isomer

Sign In for Pricing
View Details
TTC9B Human qPCR Primer Pair (BC029539)
HP223779 200 Reactions

TTC9B Human qPCR Primer Pair (BC029539)

Sign In for Pricing
View Details
BIK Human Gene Knockout Kit (CRISPR)
KN400546 1 Kit

BIK Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Anxa10 Mouse Gene Knockout Kit (CRISPR)
KN501331 1 Kit

Anxa10 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
USP6NL (NM_001080491) Human Over-expression Lysate
LC421046 20 µg

USP6NL (NM_001080491) Human Over-expression Lysate

Sign In for Pricing
View Details