Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-2 (TVB42)

This Recombinant Human T cell receptor beta variable 4-2 (TVB42) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-2 TRBV4-2 TCRBV7S3A2 TCRBV7S3A2T

UniProt

A0A539

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYNFKEQTENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ABCC1 Protein Vector (Rat) (pPM-C-His)
PV251413 500 ng

ABCC1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details
G protein-coupled receptor kinase 6 Rabbit Monoclonal Antibody
E46F3646 40 µL

G protein-coupled receptor kinase 6 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
ATP5ME Antibody, FITC conjugated
A41181-50UG 50 µg

ATP5ME Antibody, FITC conjugated

Sign In for Pricing
View Details
Anti Human CD18 Flow Cytometry Monoclonal Clone TS1181211 PE/TR Ready To Use 200 Tests
IMSAHUCD18TS1181211CPETR200 200 Tests

Anti Human CD18 Flow Cytometry Monoclonal Clone TS1181211 PE/TR Ready To Use 200 Tests

Sign In for Pricing
View Details
Recombinant RASGRP1 Antibody
RC-5545-01 50 μL

Recombinant RASGRP1 Antibody

Sign In for Pricing
View Details
Recombinant RASGRP1 Antibody
RC-5545-02 100 µL

Recombinant RASGRP1 Antibody

Sign In for Pricing
View Details