Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 3-1 (TVB31)

This Recombinant Human T cell receptor beta variable 3-1 (TVB31) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 3-1 TRBV3-1 TCRBV9S1A1T

UniProt

A0A576

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVSQTPKYLVTQMGNDKSIKCEQNLGHDTMYWYKQDSKKFLKIMFSYNNKELIINETVPNRFSPKSPDKAHLNLHINSLELGDSAVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Kat2a Mouse siRNA Oligo Duplex (Locus ID 14534)
SR420477 1 Kit

Kat2a Mouse siRNA Oligo Duplex (Locus ID 14534)

Sign In for Pricing
View Details
Pcmt1 sgRNA CRISPR Lentivector (Rat) (Target 2)
K6817103 1.0 µg DNA

Pcmt1 sgRNA CRISPR Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Olfr194 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4312007 1.0 µg DNA

Olfr194 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
PAGE2B (NM_001015038) Human Recombinant Protein
TP760875 50 µg

PAGE2B (NM_001015038) Human Recombinant Protein

Sign In for Pricing
View Details
VHY Double Nickase Plasmid (h2)
sc-408320-NIC-2 20 µg

VHY Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
4-Hydroxychalcone
MBS3608211-01 100 mg

4-Hydroxychalcone

Sign In for Pricing
View Details