Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41)

This Recombinant Human T cell receptor beta variable 4-1 (TVB41) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Os08g0325134 Antibody
orb842255 2 mg

Os08g0325134 Antibody

Sign In for Pricing
View Details
PDE4C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)
K1618206 1.0 µg DNA

PDE4C sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
TAF1B Conjugated Antibody
MBS9452688-01 0.1 mL (AF350)

TAF1B Conjugated Antibody

Sign In for Pricing
View Details
TAF1B Conjugated Antibody
MBS9452688-02 0.1 mL (AF405)

TAF1B Conjugated Antibody

Sign In for Pricing
View Details
TAF1B Conjugated Antibody
MBS9452688-03 0.1 mL (AF488)

TAF1B Conjugated Antibody

Sign In for Pricing
View Details
TAF1B Conjugated Antibody
MBS9452688-04 0.1 mL (AF555)

TAF1B Conjugated Antibody

Sign In for Pricing
View Details