Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-1 (TVB41)

This Recombinant Human T cell receptor beta variable 4-1 (TVB41) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-1 TRBV4-1 TCRBV7S1A1N2T

UniProt

A0A577

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

EVTQTPKHLVMGMTNKKSLKCEQHMGHRAMYWYKQKAKKPPELMFVYSYEKLSINESVPSRFSPECPNSSLLNLHLHALQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitofusin 2 (MFN2) (NM_001127660) Human Tagged ORF Clone
RC226143 10 µg

Mitofusin 2 (MFN2) (NM_001127660) Human Tagged ORF Clone

Sign In for Pricing
View Details
Rapsn (NM_001108584) Rat Tagged Lenti ORF Clone
RR203895L3 10 µg

Rapsn (NM_001108584) Rat Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Alicapistat
BA8287-1 1 mg

Alicapistat

Sign In for Pricing
View Details
HSDL1 rabbit pAb
MBS8598571-01 0.1 mL

HSDL1 rabbit pAb

Sign In for Pricing
View Details
HSDL1 rabbit pAb
MBS8598571-02 0.1 mL (AF405L)

HSDL1 rabbit pAb

Sign In for Pricing
View Details
HSDL1 rabbit pAb
MBS8598571-03 0.1 mL (AF405S)

HSDL1 rabbit pAb

Sign In for Pricing
View Details