Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-1 (TVB51)

This Recombinant Human T cell receptor beta variable 5-1 (TVB51) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-1 TRBV5-1 TCRBV5S1A1T

UniProt

A0A578

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRYLIKTRGQQVTLSCSPISGHRSVSWYQQTPGQGLQFLFEYFSETQRNKGNFPGRFSGRQFSNSRSEMNVSTLELGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDP1 Human Gene Knockout Kit (CRISPR)
KN401888 1 Kit

TDP1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI2D5]
CF806182 100 µg

Peripherin (PRPH) Mouse Monoclonal Antibody [Clone ID: OTI2D5]

Sign In for Pricing
View Details
Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF740 conjugate, 0.1mg/mL
BNC741683-100 1x 100 µL

Factor XIIIa (Coagulation Factor XIIIA Chain) (F13A1/1683), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Lactate Microplate Assay Kit
RDSM163 100 Assays

Lactate Microplate Assay Kit

Sign In for Pricing
View Details
CLK1 (NM_004071) Human Over-expression Lysate
LY418237 100 µg

CLK1 (NM_004071) Human Over-expression Lysate

Sign In for Pricing
View Details
Major Vault Protein (MVP) (VP2897R), 0.2mg/mL
BNUB2897-500 1x 500 µL

Major Vault Protein (MVP) (VP2897R), 0.2mg/mL

Sign In for Pricing
View Details