Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 4-3 (TVB43)

This Recombinant Human T cell receptor beta variable 4-3 (TVB43) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 4-3 TRBV4-3 TCRBV7S2A1N4T

UniProt

A0A589

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQTPRHLVMGMTNKKSLKCEQHLGHNAMYWYKQSAKKPLELMFVYSLEERVENNSVPSRFSPECPNSSHLFLHLHTLQPEDSALYLCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ITPR3 Polyclonal Antibody PE Conjugated
orb1539826 100 µL

ITPR3 Polyclonal Antibody PE Conjugated

Sign In for Pricing
View Details
APC2 Polyclonal Antibody, APC Conjugated
bs-12485R-APC 100 µL

APC2 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
1700016K19Rik Lentiviral Activation Particles (m2)
sc-428800-LAC-2 200 µL

1700016K19Rik Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
NETO2 Antibody
E38QA7124 100 µL

NETO2 Antibody

Sign In for Pricing
View Details
4-Fluoro-1H-indole-2-carboxylic acid
PC4875 250 mg

4-Fluoro-1H-indole-2-carboxylic acid

Sign In for Pricing
View Details
TRNAC19 AAV siRNA Pooled Vector
47932161 1.0 µg

TRNAC19 AAV siRNA Pooled Vector

Sign In for Pricing
View Details