Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55)

This Recombinant Human T cell receptor beta variable 5-5 (TVB55) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SDHDP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43264111 3x 1.0 µg

SDHDP7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)
MBS1205610-01 0.02 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)
MBS1205610-02 0.02 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)
MBS1205610-03 0.1 mg (E-Coli)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)
MBS1205610-04 0.1 mg (Yeast)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details
Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)
MBS1205610-05 0.02 mg (Baculovirus)

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae Cysteine--tRNA ligase (cysS)

Sign In for Pricing
View Details