Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55)

This Recombinant Human T cell receptor beta variable 5-5 (TVB55) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TLE2 Human Recombinant Protein
TP725805 50 µg

TLE2 Human Recombinant Protein

Sign In for Pricing
View Details
Rnf146 siRNA Oligos set (Rat)
40257176 3x 5 nmol

Rnf146 siRNA Oligos set (Rat)

Sign In for Pricing
View Details
B3GNT9 Recombinant Protein (Human)
RP048214 100 µg

B3GNT9 Recombinant Protein (Human)

Sign In for Pricing
View Details
Plant Dihydroflavonol-4- Reductase (DFR) ELISA Kit
OM625721 96 Tests

Plant Dihydroflavonol-4- Reductase (DFR) ELISA Kit

Sign In for Pricing
View Details
ALDH4A1 Rabbit Polyclonal Antibody (C-term)
E28PB4851 100 µL

ALDH4A1 Rabbit Polyclonal Antibody (C-term)

Sign In for Pricing
View Details
ITPKA Human Over-expression Lysate
orb1365247 20 µg

ITPKA Human Over-expression Lysate

Sign In for Pricing
View Details