Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-5 (TVB55)

This Recombinant Human T cell receptor beta variable 5-5 (TVB55) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-5 TRBV5-5 TCRBV5S3A2T

UniProt

A0A597

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQVTLRCSPISGHKSVSWYQQVLGQGPQFIFQYYEKEERGRGNFPDRFSARQFPNYSSELNVNALLLGDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SCLIP (h) -PR
sc-76459-PR 10 µM - 20 µL

SCLIP (h) -PR

Sign In for Pricing
View Details
Mouse Cacna2d4 Pre-designed siRNA Set A
SI101691A 1 Each

Mouse Cacna2d4 Pre-designed siRNA Set A

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)
MBS2059867-01 0.1 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)
MBS2059867-02 0.2 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)
MBS2059867-03 0.5 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details
PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)
MBS2059867-04 1 mL

PE-Linked Polyclonal Antibody to Matrix Metalloproteinase 19 (MMP19)

Sign In for Pricing
View Details