Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-8 (TVB58)

This Recombinant Human T cell receptor beta variable 5-8 (TVB58) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-8 TRBV5-8 TCRBV5S4A2T

UniProt

A0A5A2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Nocardioides sp. Chaperone protein DnaK (dnaK), partial
MBS1091719 Inquire

Recombinant Nocardioides sp. Chaperone protein DnaK (dnaK), partial

Sign In for Pricing
View Details
PTHLH sgRNA CRISPR Lentivector (Human) (Target 1)
K1752102 1.0 µg DNA

PTHLH sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
PRCP Polyclonal Antibody, FITC Conjugated
A68665-100 100 µL

PRCP Polyclonal Antibody, FITC Conjugated

Sign In for Pricing
View Details
BAFF & IL-17A Antibody
orb2990692-01 100 µg

BAFF & IL-17A Antibody

Sign In for Pricing
View Details
BAFF & IL-17A Antibody
orb2990692-02 1 mg

BAFF & IL-17A Antibody

Sign In for Pricing
View Details
Plp2 (NM_019755) Mouse Tagged Lenti ORF Clone
MR224890L3 10 µg

Plp2 (NM_019755) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details