Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 5-8 (TVB58)

This Recombinant Human T cell receptor beta variable 5-8 (TVB58) spans the amino acid sequence from region 22-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 5-8 TRBV5-8 TCRBV5S4A2T

UniProt

A0A5A2

Expression Region

22-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQSPTHLIKTRGQQATLRCSPISGHTSVYWYQQALGLGLQFLLWYDEGEERNRGNFPPRFSGRQFPNYSSELNVNALELEDSALYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ndufab1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)
K3815406 1.0 µg DNA

Ndufab1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details
Human BARHL2 Protein Lysate
MBS137853-01 0.02 mg

Human BARHL2 Protein Lysate

Sign In for Pricing
View Details
Human BARHL2 Protein Lysate
MBS137853-02 5x 0.02 mg

Human BARHL2 Protein Lysate

Sign In for Pricing
View Details
Human CCDC122 Protein Lysate
MBS138779-01 0.02 mg

Human CCDC122 Protein Lysate

Sign In for Pricing
View Details
Human CCDC122 Protein Lysate
MBS138779-02 5x 0.02 mg

Human CCDC122 Protein Lysate

Sign In for Pricing
View Details
APBA3 Recombinant Protein
OPCD01384-50UG 50 µg

APBA3 Recombinant Protein

Sign In for Pricing
View Details