Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 14 (TVB14)

This Recombinant Human T cell receptor beta variable 14 (TVB14) spans the amino acid sequence from region 22-115. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 14 TRBV14 TCRBV14S1 TCRBV16S1A1N1

UniProt

A0A5B0

Expression Region

22-115

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GVTQFPSHSVIEKGQTVTLRCDPISGHDNLYWYRRVMGKEIKFLLHFVKESKQDESGMPNNRFLAERTGGTYSTLKVQPAELEDSGVYFCASSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EIF1AY Human siRNA Oligo Duplex (Locus ID 9086)
SR306001 1 Kit

EIF1AY Human siRNA Oligo Duplex (Locus ID 9086)

Sign In for Pricing
View Details
GDC (h) -PR
sc-90626-PR 10 µM - 20 µL

GDC (h) -PR

Sign In for Pricing
View Details
FCGR2B (Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, CD32, FCG2, IGFR2) discontinued
C2384-03M 50 µg

FCGR2B (Low Affinity Immunoglobulin gamma Fc Region Receptor II-b, IgG Fc Receptor II-b, CDw32, Fc-gamma RII-b, Fc-gamma-RIIb, FcRII-b, CD32, FCG2, IGFR2) discontinued

Sign In for Pricing
View Details
Rat Fibroblast Growth Factor 4 (FGF4) ELISA Kit
EK14022 48 Tests

Rat Fibroblast Growth Factor 4 (FGF4) ELISA Kit

Sign In for Pricing
View Details
Mgll Antibody, HRP conjugated
A28528-100UG 100 µg

Mgll Antibody, HRP conjugated

Sign In for Pricing
View Details
Streptococcus agalactiae (Biotin)
MBS6249325-01 0.1 mL

Streptococcus agalactiae (Biotin)

Sign In for Pricing
View Details