Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 28 (TVB28)

This Recombinant Human T cell receptor beta variable 28 (TVB28) spans the amino acid sequence from region 27-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 28 TRBV28 TCRBV3S1

UniProt

A0A5B6

Expression Region

27-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human SHC3 Recombinant Protein (N-His)
HV158022-01 50 µg

Human SHC3 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human SHC3 Recombinant Protein (N-His)
HV158022-02 100 µg

Human SHC3 Recombinant Protein (N-His)

Sign In for Pricing
View Details
Human SHC3 Recombinant Protein (N-His)
HV158022-03 1 mg

Human SHC3 Recombinant Protein (N-His)

Sign In for Pricing
View Details
CEP192 Protein Vector (Human) (pPM-C-HA)
15901021 500 ng

CEP192 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
TPST1 (NM_003596) Human Over-expression Lysate
LH06771V 100 µg

TPST1 (NM_003596) Human Over-expression Lysate

Sign In for Pricing
View Details
Citric acid, anhydrous, 99.5%, BP, Ph. Eur., USP grade
GV4009-500g 500 g

Citric acid, anhydrous, 99.5%, BP, Ph. Eur., USP grade

Sign In for Pricing
View Details