Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 28 (TVB28)

This Recombinant Human T cell receptor beta variable 28 (TVB28) spans the amino acid sequence from region 27-114. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 28 TRBV28 TCRBV3S1

UniProt

A0A5B6

Expression Region

27-114

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

SRYLVKRTGEKVFLECVQDMDHENMFWYRQDPGLGLRLIYFSYDVKMKEKGDIPEGYSVSREKKERFSLILESASTNQTSMYLCASSL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bhlhe40 ORF Vector (Rat) (pORF)
ORF064056 1.0 µg DNA

Bhlhe40 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Mouse Netrin-1, NTN1 ELISA KIT
EA0089Mo-01 96 Well

Mouse Netrin-1, NTN1 ELISA KIT

Sign In for Pricing
View Details
Slc22a5 3'UTR Lenti-reporter-Luc Vector
43962084 1.0 µg

Slc22a5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
MOSMO (NM_001164579) Human Over-expression Lysate
LS730094-100ug 100 µg

MOSMO (NM_001164579) Human Over-expression Lysate

Sign In for Pricing
View Details
Recombinant Human NFKBIB Protein, His, E.coli-1mg
QP12836-1mg 1mg

Recombinant Human NFKBIB Protein, His, E.coli-1mg

Sign In for Pricing
View Details
CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF647 conjugate, 0.1mg/mL
BNC471464-500 1x 500 µL

CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details