Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R16B Adenovirus (Mouse)
37422054 1.0 mL

PPP1R16B Adenovirus (Mouse)

Sign In for Pricing
View Details
SEMA6D Rabbit Polyclonal Antibody (Biotin)
orb2112931 100 µL

SEMA6D Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Rabbit anti-human kinesin family member 1C polyclonal Antibody
MBS714593-01 0.1 mL

Rabbit anti-human kinesin family member 1C polyclonal Antibody

Sign In for Pricing
View Details
Rabbit anti-human kinesin family member 1C polyclonal Antibody
MBS714593-02 5x 0.1 mL

Rabbit anti-human kinesin family member 1C polyclonal Antibody

Sign In for Pricing
View Details
Bovine PLS3 / Plastin-3 Recombinant Protein
R13276b 1 Each

Bovine PLS3 / Plastin-3 Recombinant Protein

Sign In for Pricing
View Details
NLRC5 HDR Plasmid (h)
sc-410189-HDR 20 µg

NLRC5 HDR Plasmid (h)

Sign In for Pricing
View Details