Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Htr5b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)
K3935208 1.0 µg DNA

Htr5b sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)
MBS1368457-01 0.02 mg (E-Coli)

Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)
MBS1368457-02 0.02 mg (Yeast)

Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)
MBS1368457-03 0.1 mg (E-Coli)

Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)
MBS1368457-04 0.1 mg (Yeast)

Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details
Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)
MBS1368457-05 0.02 mg (Baculovirus)

Recombinant Salmonella paratyphi A Histidinol-phosphate aminotransferase (hisC)

Sign In for Pricing
View Details