Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor beta variable 29-1 (TVB29)

This Recombinant Human T cell receptor beta variable 29-1 (TVB29) spans the amino acid sequence from region 17-111. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor beta variable 29-1 TRBV29-1 TCRBV4S1A1T

UniProt

A0A5B7

Expression Region

17-111

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

AVISQKPSRDICQRGTSLTIQCQVDSQVTMMFWYRQQPGQSLTLIATANQGSEATYESGFVIDKFPISRPNLTFSTLTVSNMSPEDSSIYLCSVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Nol7 shRNA (UAS) - Lentiviral mouse Nol7 shRNA (UAS) plasmid
GTR15276859 1 Vial

Lentiviral mouse Nol7 shRNA (UAS) - Lentiviral mouse Nol7 shRNA (UAS) plasmid

Sign In for Pricing
View Details
CD79a Antibody (RPE)
orb433868 25 Tests

CD79a Antibody (RPE)

Sign In for Pricing
View Details
APOA1 Rabbit pAb, IRDye 800CW conjugated
orb2881044 100 µL

APOA1 Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
NCBP2 Antibody Blocking peptide
orb1451540 500 µg

NCBP2 Antibody Blocking peptide

Sign In for Pricing
View Details
PE-Cy5 Anti-Mouse/Human CD11b Antibody (M1/70)
PC5-30072U-01 25 µg

PE-Cy5 Anti-Mouse/Human CD11b Antibody (M1/70)

Sign In for Pricing
View Details
PE-Cy5 Anti-Mouse/Human CD11b Antibody (M1/70)
PC5-30072U-02 100 µg

PE-Cy5 Anti-Mouse/Human CD11b Antibody (M1/70)

Sign In for Pricing
View Details