Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Micropeptide inhibiting actin cytoskeleton (MIAC)

This Recombinant Human Micropeptide inhibiting actin cytoskeleton (MIAC) spans the amino acid sequence from region 1-51. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Micropeptide inhibiting actin cytoskeleton AQP5-AS1 MIAC

UniProt

A0A7L8Y648

Expression Region

1-51

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research; Cell Biology

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MERAGVPGFSPRRSSVEAKMQSTSCSVRKSSTVTAWPAVVLLLSWGQRRGG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhesus IL18 Protein, His Tag
E40PM155 20 µg

Rhesus IL18 Protein, His Tag

Sign In for Pricing
View Details
N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide
273886-01 500 mg

N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide

Sign In for Pricing
View Details
N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide
273886-02 1 g

N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide

Sign In for Pricing
View Details
N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide
273886-03 2 g

N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide

Sign In for Pricing
View Details
N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide
273886-04 5 g

N-alpha-[2,4-Dinitro-5-fluorophenyl]-D-alanine amide

Sign In for Pricing
View Details
Recombinant Human Interleukin-37/IL-37
C073-1mg 1 mg

Recombinant Human Interleukin-37/IL-37

Sign In for Pricing
View Details