Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T cell receptor delta variable 3 (TRDV3)

This Recombinant Human T cell receptor delta variable 3 (TRDV3) spans the amino acid sequence from region 19-113. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T cell receptor delta variable 3 TRDV3 hDV103S1

UniProt

A0JD37

Expression Region

19-113

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

DKVTQSSPDQTVASGSEVVLLCTYDTVYSNPDLFWYRIRPDYSFQFVFYGDNSRSEGADFTQGRFSVKHILTQKAFHLVISPVRTEDSATYYCAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)
MBS6482968-01 0.1 mL

Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)

Sign In for Pricing
View Details
Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)
MBS6482968-02 5x 0.1 mL

Interleukin 10 Receptor alpha (IL10RA, IL-10RA, IL-10R-A, CDw210a, HIL-10R, IL-10R1, IL10R) (MaxLight 405)

Sign In for Pricing
View Details
ICOS Ligand, Mouse IgG2a Fc Fusion Protein (Inducible T-cell Co-stimulator Ligand, ICOSL, ICOS-L, ICOSLG, B7 Homolog 2, B7H2, B7-H2, B7-like Protein Gl50, B7-related Protein 1, B7RP1, B7RP-1, CD275, GL50, KIAA0653, LICOS)
I0650-05D 25 µg

ICOS Ligand, Mouse IgG2a Fc Fusion Protein (Inducible T-cell Co-stimulator Ligand, ICOSL, ICOS-L, ICOSLG, B7 Homolog 2, B7H2, B7-H2, B7-like Protein Gl50, B7-related Protein 1, B7RP1, B7RP-1, CD275, GL50, KIAA0653, LICOS)

Sign In for Pricing
View Details
Olfr860 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4250207 1.0 µg DNA

Olfr860 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
CL-0309-502 AF Systems Consumables
032654 Roll of 500 Label(s)

CL-0309-502 AF Systems Consumables

Sign In for Pricing
View Details
ERV3-1 Protein Vector (Human) (pPM-C-HA)
PV075891 500 ng

ERV3-1 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details