Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NBPF family member NBPF26 (NBPFP), partial

This Recombinant Human NBPF family member NBPF26 (NBPFP), partial spans the amino acid sequence from region 1575-1673. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NBPF family member NBPF26; Neuroblastoma breakpoint family member 26; NBPF26

UniProt

B4DH59

Expression Region

1575-1673

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

ERRRGRKEGEEDQNPPCPRLNSMLMEVEEPEVLQDSLDICYSTPSMYFELPDSFQHYRSVFYSFEEEHISFALYVDNRFFTLTVTSLHLVFQMGVIFPQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Prokineticin-1 Rabbit Polyclonal Antibody
E28PT6278 100 µL

Prokineticin-1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Human Uncharacterized protein CXorf1 (CXorf1), partial
MBS7054545 Inquire

Recombinant Human Uncharacterized protein CXorf1 (CXorf1), partial

Sign In for Pricing
View Details
Kif12 3'UTR GFP Stable Cell Line
TU160542 1.0 mL

Kif12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Anti-Kv3.3 K+ channel Antibody (N375/84)
RHG68602 100 μg

Anti-Kv3.3 K+ channel Antibody (N375/84)

Sign In for Pricing
View Details
Pax6 sgRNA CRISPR Lentivector (Rat) (Target 1)
K6803602 1.0 µg DNA

Pax6 sgRNA CRISPR Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
CLEC1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated
bs-2542R-BF350 100 µL

CLEC1 Polyclonal Antibody, AbBy Fluor™ 350 Conjugated

Sign In for Pricing
View Details