Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP)

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gibberellic Acid Acetate
TRC-G377530-500MG 500 mg

Gibberellic Acid Acetate

Sign In for Pricing
View Details
(R)-1-([1,1'-Biphenyl]-4-yl)-3-chloropropan-2-ol
TRC-B379550-1G 1 g

(R)-1-([1,1'-Biphenyl]-4-yl)-3-chloropropan-2-ol

Sign In for Pricing
View Details
Ca2+-ATPase Activity Assay Kit
E-BC-K212-M-01 48 T (22 samples)

Ca2+-ATPase Activity Assay Kit

Sign In for Pricing
View Details
Ca2+-ATPase Activity Assay Kit
E-BC-K212-M-02 96 T (46 samples)

Ca2+-ATPase Activity Assay Kit

Sign In for Pricing
View Details
PAPP A2 (PAPPA2) (N-term) Rabbit Polyclonal Antibody
AP31246PU-N 50 µg

PAPP A2 (PAPPA2) (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cefpiramide
TRC-C243400-10MG 10 mg

Cefpiramide

Sign In for Pricing
View Details