Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Putative RNA-binding regulatory peptide (RBRP)

This Recombinant Human Putative RNA-binding regulatory peptide (RBRP) spans the amino acid sequence from region 1-71. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Putative RNA-binding regulatory peptide; RBRP; Septin 14 pseudogene 20; SEPTIN14P20 C20orf69 LINC00266-1

UniProt

C0HM01

Expression Region

1-71

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIQQEEIRKLEEEKKQLEGEIIDFYKMKAASEALQTQLSTDTKKDKHPDPYEFLLLRKIKHPGFNEELSPC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RAB13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
38299111 3x 1.0 µg

RAB13 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
COASY (NM_025233) Human Over-expression Lysate
LS080347-20ug 20 µg

COASY (NM_025233) Human Over-expression Lysate

Sign In for Pricing
View Details
SLC25A20 Polyclonal Antibody, APC Conjugated
bs-4192R-APC 100 µL

SLC25A20 Polyclonal Antibody, APC Conjugated

Sign In for Pricing
View Details
Anti-PDCL2 Antibody Picoband® PE Conjugated
A10894-1-PE 100 µg/Vial

Anti-PDCL2 Antibody Picoband® PE Conjugated

Sign In for Pricing
View Details
Bovine Glutamate decarboxylase 2 (GAD2) ELISA kit
GTR10454706 96 Well

Bovine Glutamate decarboxylase 2 (GAD2) ELISA kit

Sign In for Pricing
View Details
Ier3 (NM_133662) Mouse Tagged Lenti ORF Clone
MR201231L4 10 µg

Ier3 (NM_133662) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details