Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human NADH dehydrogenase (NDUCR), partial

This Recombinant Human NADH dehydrogenase (NDUCR), partial spans the amino acid sequence from region 1-55. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 subunit C2, isoform 2; NDUFC2-KCTD14 readthrough transcript protein; NDUFC2-KCTD14

UniProt

E9PQ53

Expression Region

1-55

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MIARRNPEPLRFLPDEARSLPPPKLTDPRLLYIGFLGYCSGLIDNLIRRRPIATA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MST3 Antibody (pThr184): ATTO 390
SPC-1032D-A390 100 µL

MST3 Antibody (pThr184): ATTO 390

Sign In for Pricing
View Details
Human MYO15B activation kit by CRISPRa
GA112796 1 Kit

Human MYO15B activation kit by CRISPRa

Sign In for Pricing
View Details
SLC24A1 Rabbit Polyclonal Antibody
TA366873 100 µL

SLC24A1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
POMZP3 (NM_012230) Human Over-expression Lysate
LY402170 100 µg

POMZP3 (NM_012230) Human Over-expression Lysate

Sign In for Pricing
View Details
Bodi Fluor™ 488 amine
702-AAT 5 mg

Bodi Fluor™ 488 amine

Sign In for Pricing
View Details
MIR4723 Human qPCR Primer Pair (MI0017359)
HP301110 200 Reactions

MIR4723 Human qPCR Primer Pair (MI0017359)

Sign In for Pricing
View Details