Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stathmin domain-containing protein 1 (STMD1)

This Recombinant Human Stathmin domain-containing protein 1 (STMD1) spans the amino acid sequence from region 2-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stathmin domain-containing protein 1 STMND1

UniProt

H3BQB6

Expression Region

2-276

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GCGPSQPAEDRRRVRAPKKGWKEEFKADVSVPHTGENCSPRMEAALTKNTVDIAEGLEQVQMGSLPGTISENSPSPSERNRRVNSDLVTNGLINKPQSLESRERQKSSDILEELIVQGIIQSHSKVFRNGESYDVTLTTTEKPLRKPPSRLKKLKIKKQVKDFTMKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Betulinic Acid
SIH-221-10MG 10 mg

Betulinic Acid

Sign In for Pricing
View Details
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), 0.2mg/mL
BNUB2227-100 1x 100 µL

GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), 0.2mg/mL

Sign In for Pricing
View Details
Recombinant FAM50A Antibody
RC-4848-01 50 μL

Recombinant FAM50A Antibody

Sign In for Pricing
View Details
Recombinant FAM50A Antibody
RC-4848-02 100 µL

Recombinant FAM50A Antibody

Sign In for Pricing
View Details
Recombinant FAM50A Antibody
RC-4848-03 1 mL

Recombinant FAM50A Antibody

Sign In for Pricing
View Details
RAP1B (NM_001010942) Human Recombinant Protein
TP321793L 1 mg

RAP1B (NM_001010942) Human Recombinant Protein

Sign In for Pricing
View Details