Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stathmin domain-containing protein 1 (STMD1)

This Recombinant Human Stathmin domain-containing protein 1 (STMD1) spans the amino acid sequence from region 2-276. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stathmin domain-containing protein 1 STMND1

UniProt

H3BQB6

Expression Region

2-276

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

GCGPSQPAEDRRRVRAPKKGWKEEFKADVSVPHTGENCSPRMEAALTKNTVDIAEGLEQVQMGSLPGTISENSPSPSERNRRVNSDLVTNGLINKPQSLESRERQKSSDILEELIVQGIIQSHSKVFRNGESYDVTLTTTEKPLRKPPSRLKKLKIKKQVKDFTMKDIEEKMEAAEERRKTKEEEIRKRLRSDRLLPSANHSDSAELDGAEVAFAKGLQRVRSAGFEPSDLQGGKPLKRKKSKCDATLIDRNESDESFGVVESDMSYNQADDIVY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DYRK1B (NM_004714) Human Over-expression Lysate
LC401491 20 µg

DYRK1B (NM_004714) Human Over-expression Lysate

Sign In for Pricing
View Details
VGCNL1 (NALCN) Human Gene Knockout Kit (CRISPR)
KN417074 1 Kit

VGCNL1 (NALCN) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human JDP2 activation kit by CRISPRa
GA114793 1 Kit

Human JDP2 activation kit by CRISPRa

Sign In for Pricing
View Details
Tissue FFPE Sections, Bone: tibia, distal
CS707200 5x 5 µm

Tissue FFPE Sections, Bone: tibia, distal

Sign In for Pricing
View Details
Human Prostein (SLC45A3) activation kit by CRISPRa
GA113875 1 Kit

Human Prostein (SLC45A3) activation kit by CRISPRa

Sign In for Pricing
View Details
C12orf40 Rabbit Polyclonal Antibody
TA365542 100 µL

C12orf40 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details