Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial

This Recombinant Human SLC35A4 upstream open reading frame protein (S35U4), partial spans the amino acid sequence from region 1-61. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SLC35A4 upstream open reading frame protein; SLC35A4 microprotein; SLC35A4-MP; SLC35A4

UniProt

L0R6Q1

Expression Region

1-61

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

MADDKDSLPKLKDLAFLKNQLESLQRRVEDEVNSGVGQDGSLLSSPFLKGFLAGYVVAKLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALDH1B1 Protein Vector (Rat) (pPM-C-HA)
11727026 500 ng

ALDH1B1 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details
HIP-55 (h2) : 293T Lysate
sc-371066 100 µg - 200 µL

HIP-55 (h2) : 293T Lysate

Sign In for Pricing
View Details
Endo180 Rabbit Polyclonal Antibody
E53P03749 100 µL

Endo180 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
TNNT2  Antibody
ABD6261 100 µg

TNNT2 Antibody

Sign In for Pricing
View Details
Anti-NR2F1 antibody
PAab05843 100 µg

Anti-NR2F1 antibody

Sign In for Pricing
View Details
PIG54 Polyclonal Antibody, PerCP-Cy5.5 Conjugated
bs-6937R-PerCP-Cy5.5 100 µL

PIG54 Polyclonal Antibody, PerCP-Cy5.5 Conjugated

Sign In for Pricing
View Details