Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial

This Recombinant Human Mitochondrial pyruvate carrier 1-like protein (MPC1L), partial spans the amino acid sequence from region 75-136. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mitochondrial pyruvate carrier 1-like protein MPC1L

UniProt

P0DKB6

Expression Region

75-136

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

VQPRNLLLMACHCTNVMAQSVQASRYLLYYYGGGGAEAKARDPPATAAAATSPGSQPPKQAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3-Aminobutanoyl-CoA
HY-CE00842 1 Each

3-Aminobutanoyl-CoA

Sign In for Pricing
View Details
Entecavir 5mg
A17569-5 5 mg

Entecavir 5mg

Sign In for Pricing
View Details
KRTAP25-1 (NM_001128598) Human Tagged ORF Clone
RC225022 10 µg

KRTAP25-1 (NM_001128598) Human Tagged ORF Clone

Sign In for Pricing
View Details
TTR Antibody, HRP conjugated
A44829-100UG 100 µg

TTR Antibody, HRP conjugated

Sign In for Pricing
View Details
Pigeon Low Density Lipoprotein Receptor Related Protein 5 ELISA Kit
MBS051353 Inquire

Pigeon Low Density Lipoprotein Receptor Related Protein 5 ELISA Kit

Sign In for Pricing
View Details
Rabbit Anti-Human PISD pAb
PA13769-01 50 μL

Rabbit Anti-Human PISD pAb

Sign In for Pricing
View Details