Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Olfactory receptor 12D1 (O12D1), partial

This Recombinant Human Olfactory receptor 12D1 (O12D1), partial spans the amino acid sequence from region 163-203. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Olfactory receptor 12D1 OR12D1 OR12D1P

UniProt

P0DN82

Expression Region

163-203

Origin

Homo sapiens (Human)

Field of Research

Neuroscience; Metabolism Research

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

RLNFCGSNRIYHFFCDVKPLLKLACGNTELNQWLLSTVTGT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MARCKS like protein (MARCKSL1) Rabbit Polyclonal Antibody
TA370753 100 µL

MARCKS like protein (MARCKSL1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
STX16 Polyclonal Antibody
E-AB-67957-01 60 µL

STX16 Polyclonal Antibody

Sign In for Pricing
View Details
STX16 Polyclonal Antibody
E-AB-67957-02 120 µL

STX16 Polyclonal Antibody

Sign In for Pricing
View Details
STX16 Polyclonal Antibody
E-AB-67957-03 200 µL

STX16 Polyclonal Antibody

Sign In for Pricing
View Details
MITD1 (NM_138798) Human Recombinant Protein
TP304503L 1 mg

MITD1 (NM_138798) Human Recombinant Protein

Sign In for Pricing
View Details
L-Citrulline
TRC-C535700-5G 5 g

L-Citrulline

Sign In for Pricing
View Details