Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108)

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NGAL Antibody Pair Set
E-KAB-0058 50 µL & 100 µg

Human NGAL Antibody Pair Set

Sign In for Pricing
View Details
Human Transthyretin/TTR, Tag Free
HA211085-01 Inquire

Human Transthyretin/TTR, Tag Free

Sign In for Pricing
View Details
Human Transthyretin/TTR, Tag Free
HA211085-02 100 µg

Human Transthyretin/TTR, Tag Free

Sign In for Pricing
View Details
Recombinant Rat Layilin/LAYN Protein (Fc Tag)
PKSR030172 50 µg

Recombinant Rat Layilin/LAYN Protein (Fc Tag)

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung: left upper lobe
CS715851 5x 5 µm

Tissue FFPE Sections, Lung: left upper lobe

Sign In for Pricing
View Details
Mouse Mptx1 activation kit by CRISPRa
GA206689 1 Kit

Mouse Mptx1 activation kit by CRISPRa

Sign In for Pricing
View Details