Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108)

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Abcd2 Mouse Gene Knockout Kit (CRISPR)
KN500632 1 Kit

Abcd2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Frozen Tissue Sections, Rectum
CS503080 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
Mouse Potassium Inwardly Rectifying Channel Subfamily J, Member 5 (KCNJ5) ELISA Kit
RDR-KCNJ5-Mu-01 96 Tests

Mouse Potassium Inwardly Rectifying Channel Subfamily J, Member 5 (KCNJ5) ELISA Kit

Sign In for Pricing
View Details
Mouse Potassium Inwardly Rectifying Channel Subfamily J, Member 5 (KCNJ5) ELISA Kit
RDR-KCNJ5-Mu-02 48 Tests

Mouse Potassium Inwardly Rectifying Channel Subfamily J, Member 5 (KCNJ5) ELISA Kit

Sign In for Pricing
View Details
Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF568 conjugate, 0.1mg/mL
BNC682200-100 1x 100 µL

Cytokeratin 7 (Glandular and Transitional Epithelial Marker) (KRT7/2200), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PCCA Mouse Monoclonal Antibody [Clone ID: OTI1B10]
CF810969 100 µg

PCCA Mouse Monoclonal Antibody [Clone ID: OTI1B10]

Sign In for Pricing
View Details