Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 1-8 (HV108)

This Recombinant Human Immunoglobulin heavy variable 1-8 (HV108) spans the amino acid sequence from region 20-117. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 1-8 IGHV1-8

UniProt

P0DP01

Expression Region

20-117

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLVQSGAEVKKPGASVKVSCKASGYTFTSYDINWVRQATGQGLEWMGWMNPNSGNTGYAQKFQGRVTMTRNTSISTAYMELSSLRSEDTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti-Norovirus GII.3 Polyclonal antibody
CABT-CS954 100 μg

Rabbit Anti-Norovirus GII.3 Polyclonal antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/1346) [mFluor Violet 610 SE]
NBP2-54520MFV610 0.1 mL

Mouse Monoclonal Cytokeratin 8/18 Antibody (KRT8.18/1346) [mFluor Violet 610 SE]

Sign In for Pricing
View Details
MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoylated 1)
038564 200 µL

MPP1, ID (MPP1, DXS552E, EMP55, 55kD erythrocyte membrane protein, Membrane protein, palmitoylated 1)

Sign In for Pricing
View Details
Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (FITC)
138398-FITC 100 µL

Stromal Cell Derived Factor 2 (SDF2, Stromal Cell-derived Factor 2, SDF-2) (FITC)

Sign In for Pricing
View Details
IKBKAP Protein Vector (Mouse) (pPM-C-His)
PV191109 500 ng

IKBKAP Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
PIG-H Polyclonal Antibody
RA28759-01 50 µL

PIG-H Polyclonal Antibody

Sign In for Pricing
View Details