Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Immunoglobulin heavy variable 4-31 (HV431)

This Recombinant Human Immunoglobulin heavy variable 4-31 (HV431) spans the amino acid sequence from region 20-118. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Immunoglobulin heavy variable 4-31 IGHV4-31

UniProt

P0DP07

Expression Region

20-118

Origin

Homo sapiens (Human)

Endotoxin

Not test

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Storage Conditions

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 20%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

AA Sequence

QVQLQESGPGLVKPSQTLSLTCTVSGGSISSGGYYWSWIRQHPGKGLEWIGYIYYSGSTYYNPSLKSLVTISVDTSKNQFSLKLSSVTAADTAVYYCAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

D,L-myo-Inositol-1-(n-butylfluoresceinylphosphate) Lithium Salt, ~80%
TRC-I665700-5MG 5 mg

D,L-myo-Inositol-1-(n-butylfluoresceinylphosphate) Lithium Salt, ~80%

Sign In for Pricing
View Details
5-CR110-PEO3-amine, TFA salt
#90106 1x 5 mg

5-CR110-PEO3-amine, TFA salt

Sign In for Pricing
View Details
AR-C133913XX
TRC-A766550-250MG 250 mg

AR-C133913XX

Sign In for Pricing
View Details
TAFA1 (NM_213609) Human Over-expression Lysate
LY403887 100 µg

TAFA1 (NM_213609) Human Over-expression Lysate

Sign In for Pricing
View Details
ATP6V0C (NM_001694) Human Over-expression Lysate
LY419794 100 µg

ATP6V0C (NM_001694) Human Over-expression Lysate

Sign In for Pricing
View Details
PGC Antibody
KC-32366-01 50 μL

PGC Antibody

Sign In for Pricing
View Details